PIGQ Antikörper (N-Term)
-
- Target Alle PIGQ Antikörper anzeigen
- PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIGQ Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PIGQ antibody was raised against the N terminal of PIGQ
- Aufreinigung
- Affinity purified
- Immunogen
- PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS
- Top Product
- Discover our top product PIGQ Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIGQ Blocking Peptide, catalog no. 33R-7400, is also available for use as a blocking control in assays to test for specificity of this PIGQ antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGQ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))
- Andere Bezeichnung
- PIGQ (PIGQ Produkte)
- Hintergrund
- PIGQ is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGQ is a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).
- Molekulargewicht
- 65 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-