PIGQ Antikörper (N-Term)

Produktnummer ABIN635220

Produktdetails anti-PIGQ Antikörper

Target: PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIGQ Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIGQ antibody was raised against the N terminal of PIGQ

Aufreinigung: Affinity purified

Immunogen: PIGQ antibody was raised using the N terminal of PIGQ corresponding to a region with amino acids PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGQ Blocking Peptide, catalog no. 33R-7400, is also available for use as a blocking control in assays to test for specificity of this PIGQ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGQ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIGQ

Target: PIGQ (Phosphatidylinositol Glycan Anchor Biosynthesis, Class Q (PIGQ))

Andere Bezeichnung: PIGQ (PIGQ Produkte)

Synonyme: GPI1 antikoerper, c407A10.1 antikoerper, Gpi1 antikoerper, Gpi1h antikoerper, Gpi1p antikoerper, Gpih antikoerper, phosphatidylinositol glycan anchor biosynthesis class Q antikoerper, phosphatidylinositol glycan anchor biosynthesis, class Q antikoerper, PIGQ antikoerper, Pigq antikoerper

Hintergrund: PIGQ is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGQ is a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI).

Molekulargewicht: 65 kDa (MW of target protein)

Pathways: Inositol Metabolic Process