Fc epsilon RI/FCER1A Antikörper (N-Term)
-
- Target Alle Fc epsilon RI/FCER1A (FCER1A) Antikörper anzeigen
- Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Fc epsilon RI/FCER1A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FCER1 A antibody was raised against the N terminal of FCER1
- Aufreinigung
- Affinity purified
- Immunogen
- FCER1 A antibody was raised using the N terminal of FCER1 corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK
- Top Product
- Discover our top product FCER1A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FCER1A Blocking Peptide, catalog no. ABIN5613559, is also available for use as a blocking control in assays to test for specificity of this FCER1A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCER0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))
- Andere Bezeichnung
- FCER1A (FCER1A Produkte)
- Synonyme
- FCER1A antikoerper, FCE1A antikoerper, FcERI antikoerper, Iger01 antikoerper, RATIGER01 antikoerper, Fce1a antikoerper, Fcr-5 antikoerper, fcepsilonri antikoerper, Fc fragment of IgE receptor Ia antikoerper, Fc receptor, IgE, high affinity I, alpha polypeptide antikoerper, FCER1A antikoerper, Fcer1a antikoerper
- Hintergrund
- The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- Fc-epsilon Rezeptor Signalübertragung, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process
-