Fc epsilon RI/FCER1A Antikörper (N-Term)

Produktnummer ABIN635223

Produktdetails anti-Fc epsilon RI/FCER1A Antikörper

Target: Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Fc epsilon RI/FCER1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FCER1 A antibody was raised against the N terminal of FCER1

Aufreinigung: Affinity purified

Immunogen: FCER1 A antibody was raised using the N terminal of FCER1 corresponding to a region with amino acids NPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FCER1A Blocking Peptide, catalog no. ABIN5613559, is also available for use as a blocking control in assays to test for specificity of this FCER1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FCER0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Fc epsilon RI/FCER1A

Target: Fc epsilon RI/FCER1A (FCER1A) (Fc Fragment of IgE Receptor Ia (FCER1A))

Andere Bezeichnung: FCER1A (FCER1A Produkte)

Synonyme: FCER1A antikoerper, FCE1A antikoerper, FcERI antikoerper, Iger01 antikoerper, RATIGER01 antikoerper, Fce1a antikoerper, Fcr-5 antikoerper, fcepsilonri antikoerper, Fc fragment of IgE receptor Ia antikoerper, Fc receptor, IgE, high affinity I, alpha polypeptide antikoerper, FCER1A antikoerper, Fcer1a antikoerper

Hintergrund: The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process