ORCTL-2/SLC22A18 Antikörper (N-Term)

Produktnummer ABIN635226

Produktdetails anti-ORCTL-2/SLC22A18 Antikörper

Target: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ORCTL-2/SLC22A18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC22 A18 antibody was raised against the N terminal of SLC22 18

Aufreinigung: Affinity purified

Immunogen: SLC22 A18 antibody was raised using the N terminal of SLC22 18 corresponding to a region with amino acids AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERPAALGRLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC22A18 Blocking Peptide, catalog no. 33R-1050, is also available for use as a blocking control in assays to test for specificity of this SLC22A18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ORCTL-2/SLC22A18

Target: ORCTL-2/SLC22A18 (SLC22A18) (Solute Carrier Family 22 Member 18 (SLC22A18))

Andere Bezeichnung: SLC22A18 (SLC22A18 Produkte)

Synonyme: MGC123168 antikoerper, zgc:123168 antikoerper, BWR1A antikoerper, BWSCR1A antikoerper, HET antikoerper, IMPT1 antikoerper, ITM antikoerper, ORCTL2 antikoerper, SLC22A1L antikoerper, TSSC5 antikoerper, p45-BWR1A antikoerper, AW260131 antikoerper, Impt1 antikoerper, Orctl2 antikoerper, Slc22a1l antikoerper, solute carrier family 22, member 18 antikoerper, solute carrier family 22 member 18 antikoerper, solute carrier family 22 (organic cation transporter), member 18 antikoerper, slc22a18 antikoerper, SLC22A18 antikoerper, Slc22a18 antikoerper

Hintergrund: This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene may play a role in malignancies and disease that involve this region as well as the transport of chloroquine- and quinidine-related compounds in the kidney.

Molekulargewicht: 45 kDa (MW of target protein)