BACE2 Antikörper (N-Term)

Produktnummer ABIN635235

Produktdetails anti-BACE2 Antikörper

Target: BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BACE2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BACE2 antibody was raised against the N terminal of BACE2

Aufreinigung: Affinity purified

Immunogen: BACE2 antibody was raised using the N terminal of BACE2 corresponding to a region with amino acids PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BACE2 Blocking Peptide, catalog no. 33R-6958, is also available for use as a blocking control in assays to test for specificity of this BACE2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BACE2

Target: BACE2 (beta-Site APP-Cleaving Enzyme 2 (BACE2))

Andere Bezeichnung: BACE2 (BACE2 Produkte)

Synonyme: AEPLC antikoerper, ALP56 antikoerper, ASP1 antikoerper, ASP21 antikoerper, BAE2 antikoerper, CEAP1 antikoerper, DRAP antikoerper, 1110059C24Rik antikoerper, AI850424 antikoerper, ARP1 antikoerper, CDA13 antikoerper, beta-site APP-cleaving enzyme 2 antikoerper, BACE2 antikoerper, Bace2 antikoerper

Hintergrund: Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

Molekulargewicht: 37 kDa (MW of target protein)