RNF170 Antikörper (Middle Region)
-
- Target Alle RNF170 Antikörper anzeigen
- RNF170 (Ring Finger Protein 170 (RNF170))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF170 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RNF170 antibody was raised against the middle region of RNF170
- Aufreinigung
- Affinity purified
- Immunogen
- RNF170 antibody was raised using the middle region of RNF170 corresponding to a region with amino acids CIIAYWRYGSWLGAISCPICRQTVTLLLTVFGEDDQSQDVLRLHQDINDY
- Top Product
- Discover our top product RNF170 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNF170 Blocking Peptide, catalog no. 33R-1717, is also available for use as a blocking control in assays to test for specificity of this RNF170 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF170 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF170 (Ring Finger Protein 170 (RNF170))
- Andere Bezeichnung
- RNF170 (RNF170 Produkte)
- Synonyme
- SNAX1 antikoerper, 6720407G21Rik antikoerper, AI481227 antikoerper, ring finger protein 170 antikoerper, ring finger protein 170 L homeolog antikoerper, microRNA 4469 antikoerper, Rnf170 antikoerper, RNF170 antikoerper, rnf170.L antikoerper, MIR4469 antikoerper
- Hintergrund
- RNF170 is a multi-pass membrane proteinPotential. It contains 1 RING-type zinc finger. The exact function of RNF170 remains unknown.
- Molekulargewicht
- 30 kDa (MW of target protein)
-