RNF182 Antikörper (Middle Region)
-
- Target Alle RNF182 Antikörper anzeigen
- RNF182 (Ring Finger Protein 182 (RNF182))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNF182 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RNF182 antibody was raised against the middle region of RNF182
- Aufreinigung
- Affinity purified
- Immunogen
- RNF182 antibody was raised using the middle region of RNF182 corresponding to a region with amino acids LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY
- Top Product
- Discover our top product RNF182 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNF182 Blocking Peptide, catalog no. 33R-5457, is also available for use as a blocking control in assays to test for specificity of this RNF182 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF182 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNF182 (Ring Finger Protein 182 (RNF182))
- Andere Bezeichnung
- RNF182 (RNF182 Produkte)
- Synonyme
- C630023L15Rik antikoerper, RGD1560399 antikoerper, ring finger protein 182 antikoerper, ring finger protein 182 L homeolog antikoerper, RNF182 antikoerper, Rnf182 antikoerper, rnf182.L antikoerper
- Hintergrund
- RNF182 is a multi-pass membrane protein. It contains 1 RING-type zinc finger. The function of RNF182 remains unknown.
- Molekulargewicht
- 27 kDa (MW of target protein)
-