SLC41A3 Antikörper (C-Term)
-
- Target Alle SLC41A3 Produkte
- SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC41A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC41 A3 antibody was raised against the C terminal of SLC41 3
- Aufreinigung
- Affinity purified
- Immunogen
- SLC41 A3 antibody was raised using the C terminal of SLC41 3 corresponding to a region with amino acids WHQALDPDNHCIPYLTGLGDLLGSSSVGHTAAVPRRCTASPGWGLIQPFI
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC41A3 Blocking Peptide, catalog no. 33R-9954, is also available for use as a blocking control in assays to test for specificity of this SLC41A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC41A3 (Solute Carrier Family 41, Member 3 (SLC41A3))
- Andere Bezeichnung
- SLC41A3 (SLC41A3 Produkte)
- Hintergrund
- SLC41A3 is a multi-pass membrane protein. It belongs to the SLC41A transporter family. The exact function of SLC41A3 remains unknown.
- Molekulargewicht
- 55 kDa (MW of target protein)
-