USP48 Antikörper (C-Term)
-
- Target Alle USP48 Antikörper anzeigen
- USP48 (Ubiquitin Specific Peptidase 48 (USP48))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser USP48 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- USP48 antibody was raised against the C terminal of USP48
- Aufreinigung
- Affinity purified
- Immunogen
- USP48 antibody was raised using the C terminal of USP48 corresponding to a region with amino acids PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCS
- Top Product
- Discover our top product USP48 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
USP48 Blocking Peptide, catalog no. 33R-7311, is also available for use as a blocking control in assays to test for specificity of this USP48 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of USP48 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- USP48 (Ubiquitin Specific Peptidase 48 (USP48))
- Andere Bezeichnung
- USP48 (USP48 Produkte)
- Hintergrund
- USP48 is a protein containing domains that associate it with the peptidase family C19, also known as family 2 of ubiquitin carboxyl-terminal hydrolases. Family members function as deubiquitinating enzymes, recognizing and hydrolyzing the peptide bond at the C-terminal glycine of ubiquitin. Enzymes in peptidase family C19 are involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins.
- Molekulargewicht
- 70 kDa (MW of target protein)
-