PIEZO2 Antikörper (Middle Region)
-
- Target Alle PIEZO2 (FAM38B) Antikörper anzeigen
- PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PIEZO2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM38 B antibody was raised against the middle region of FAM38
- Aufreinigung
- Affinity purified
- Immunogen
- FAM38 B antibody was raised using the middle region of FAM38 corresponding to a region with amino acids AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS
- Top Product
- Discover our top product FAM38B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM38B Blocking Peptide, catalog no. 33R-1212, is also available for use as a blocking control in assays to test for specificity of this FAM38B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))
- Andere Bezeichnung
- FAM38B (FAM38B Produkte)
- Hintergrund
- The exact function of FAM38B remains unknown.
- Molekulargewicht
- 63 kDa (MW of target protein)
-