PIEZO2 Antikörper (Middle Region)

Produktnummer ABIN635249

Produktdetails anti-PIEZO2 Antikörper

Target: PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIEZO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM38 B antibody was raised against the middle region of FAM38

Aufreinigung: Affinity purified

Immunogen: FAM38 B antibody was raised using the middle region of FAM38 corresponding to a region with amino acids AGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM38B Blocking Peptide, catalog no. 33R-1212, is also available for use as a blocking control in assays to test for specificity of this FAM38B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIEZO2

Target: PIEZO2 (FAM38B) (Family with Sequence Similarity 38, Member B (FAM38B))

Andere Bezeichnung: FAM38B (FAM38B Produkte)

Hintergrund: The exact function of FAM38B remains unknown.

Molekulargewicht: 63 kDa (MW of target protein)