Tetraspanin 17 Antikörper (N-Term)
-
- Target Alle Tetraspanin 17 (TSPAN17) Produkte
- Tetraspanin 17 (TSPAN17)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Tetraspanin 17 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Tetraspanin 17 antibody was raised against the N terminal of TSPAN17
- Aufreinigung
- Affinity purified
- Immunogen
- Tetraspanin 17 antibody was raised using the N terminal of TSPAN17 corresponding to a region with amino acids GVMSVLGFAGCIGALRENTFLLKFFSVFLGLIFFLELATGILAFVFKDWI
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Tetraspanin 17 Blocking Peptide, catalog no. 33R-3647, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 17 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN17 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tetraspanin 17 (TSPAN17)
- Andere Bezeichnung
- Tetraspanin 17 (TSPAN17 Produkte)
- Synonyme
- fc49c03 antikoerper, wu:fc49c03 antikoerper, zgc:158284 antikoerper, Tspan-17 antikoerper, fbxo23 antikoerper, MGC89422 antikoerper, GB11399 antikoerper, tetraspanin 17 antikoerper, FBX23 antikoerper, FBXO23 antikoerper, TM4SF17 antikoerper, 2210021G21Rik antikoerper, AI047581 antikoerper, Fbxo23 antikoerper, Tm4sf17 antikoerper, GHB-R antikoerper, tetraspanin 17 antikoerper, tetraspanin 17 S homeolog antikoerper, CD63 antigen antikoerper, tetraspanin-17 protein antikoerper, tspan17 antikoerper, tspan17.S antikoerper, TSPAN17 antikoerper, LOC552721 antikoerper, TET17 antikoerper, Tspan17 antikoerper
- Hintergrund
- The function of Tetraspanin 17 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 37 kDa (MW of target protein)
-