DCST1 Antikörper (C-Term)

Produktnummer ABIN635257

Produktdetails anti-DCST1 Antikörper

Target: DCST1 (DC-STAMP Domain Containing 1 (DCST1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DCST1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DCST1 antibody was raised against the C terminal of DCST1

Aufreinigung: Affinity purified

Immunogen: DCST1 antibody was raised using the C terminal of DCST1 corresponding to a region with amino acids SYVCRTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DCST1 Blocking Peptide, catalog no. 33R-8960, is also available for use as a blocking control in assays to test for specificity of this DCST1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCST1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DCST1

Target: DCST1 (DC-STAMP Domain Containing 1 (DCST1))

Andere Bezeichnung: DCST1 (DCST1 Produkte)

Synonyme: Dcst1 antikoerper, RGD1307756 antikoerper, A330106H01Rik antikoerper, DC-STAMP domain containing 1 antikoerper, DCST1 antikoerper, dcst1 antikoerper, Sulku_2582 antikoerper, Dcst1 antikoerper

Hintergrund: The function of DCST1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 78 kDa (MW of target protein)