ABCC8 Antikörper
-
- Target Alle ABCC8 Antikörper anzeigen
- ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCC8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ABCC8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW
- Top Product
- Discover our top product ABCC8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABCC8 Blocking Peptide, catalog no. 33R-7184, is also available for use as a blocking control in assays to test for specificity of this ABCC8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCC8 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 8 (ABCC8))
- Andere Bezeichnung
- ABCC8 (ABCC8 Produkte)
- Synonyme
- ABC36 antikoerper, HHF1 antikoerper, HI antikoerper, HRINS antikoerper, MRP8 antikoerper, PHHI antikoerper, SUR antikoerper, SUR1 antikoerper, SUR1delta2 antikoerper, TNDM2 antikoerper, D930031B21Rik antikoerper, Sur antikoerper, Sur1 antikoerper, ATP binding cassette subfamily C member 8 antikoerper, ATP-binding cassette, sub-family C (CFTR/MRP), member 8 antikoerper, ABCC8 antikoerper, Abcc8 antikoerper
- Hintergrund
- ABCC8 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). ABCC8 is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion.
- Molekulargewicht
- 177 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion
-