EBP Antikörper
-
- Target Alle EBP Antikörper anzeigen
- EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser EBP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- EBP antibody was raised using a synthetic peptide corresponding to a region with amino acids LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
- Top Product
- Discover our top product EBP Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
EBP Blocking Peptide, catalog no. 33R-5513, is also available for use as a blocking control in assays to test for specificity of this EBP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EBP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EBP (Emopamil Binding Protein (Sterol Isomerase) (EBP))
- Andere Bezeichnung
- EBP (EBP Produkte)
- Synonyme
- cdpx2 antikoerper, cho2 antikoerper, cpx antikoerper, cpxd antikoerper, zgc:91895 antikoerper, CDPX2 antikoerper, CHO2 antikoerper, CPX antikoerper, CPXD antikoerper, AI255399 antikoerper, Pabp antikoerper, Td antikoerper, mSI antikoerper, emopamil binding protein (sterol isomerase) antikoerper, emopamil binding protein (sterol isomerase) L homeolog antikoerper, phenylalkylamine Ca2+ antagonist (emopamil) binding protein antikoerper, Ebp antikoerper, ebp.L antikoerper, ebp antikoerper, EBP antikoerper
- Hintergrund
- EBP is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist [3H]emopamil and the photoaffinity label [3H]azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues.
- Molekulargewicht
- 26 kDa (MW of target protein)
-