Transferrin Receptor 2 Antikörper (N-Term)

Produktnummer ABIN635270

Produktdetails anti-Transferrin Receptor 2 Antikörper

Target: Transferrin Receptor 2 (TFR2)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Transferrin Receptor 2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TFR2 antibody was raised against the N terminal of TFR2

Aufreinigung: Affinity purified

Immunogen: TFR2 antibody was raised using the N terminal of TFR2 corresponding to a region with amino acids RAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TFR2 Blocking Peptide, catalog no. 33R-7800, is also available for use as a blocking control in assays to test for specificity of this TFR2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TFR2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Transferrin Receptor 2

Target: Transferrin Receptor 2 (TFR2)

Andere Bezeichnung: TFR2 (TFR2 Produkte)

Synonyme: TFR2 antikoerper, Trfr2 antikoerper, HFE3 antikoerper, TFRC2 antikoerper, zgc:123043 antikoerper, transferrin receptor 2 antikoerper, TFR2 antikoerper, Tfr2 antikoerper, tfr2 antikoerper

Hintergrund: TFR2,a member of the transferrin receptor-like family,is a single-pass type II membrane protein with a protease associated (PA) domain, an M28 peptidase domain and a transferrin receptor-like dimerization domain. This protein mediates cellular uptake of transferrin-bound iron and mutations in this gene have been associated with hereditary hemochromatosis type III.

Molekulargewicht: 89 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis