ABCC3 Antikörper
-
- Target Alle ABCC3 Antikörper anzeigen
- ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ABCC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL
- Top Product
- Discover our top product ABCC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABCC3 Blocking Peptide, catalog no. 33R-4707, is also available for use as a blocking control in assays to test for specificity of this ABCC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))
- Andere Bezeichnung
- ABCC3 (ABCC3 Produkte)
- Synonyme
- ABC31 antikoerper, EST90757 antikoerper, MLP2 antikoerper, MOAT-D antikoerper, MRP3 antikoerper, cMOAT2 antikoerper, 1700019L09Rik antikoerper, Mlp2 antikoerper, Mrp3 antikoerper, ATP binding cassette subfamily C member 3 antikoerper, ATP-binding cassette, sub-family C (CFTR/MRP), member 3 antikoerper, ABCC3 antikoerper, Abcc3 antikoerper
- Hintergrund
- ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined, however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.
- Molekulargewicht
- 168 kDa (MW of target protein)
-