SLC44A3 Antikörper (N-Term)
-
- Target Alle SLC44A3 Produkte
- SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC44A3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC44 A3 antibody was raised against the N terminal of SLC44 3
- Aufreinigung
- Affinity purified
- Immunogen
- SLC44 A3 antibody was raised using the N terminal of SLC44 3 corresponding to a region with amino acids MGYSVVAGAAGRLLFGYDSFGNMCGKKNSPVEGAPLSGQDMTLKKHVFFM
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC44A3 Blocking Peptide, catalog no. 33R-6087, is also available for use as a blocking control in assays to test for specificity of this SLC44A3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))
- Andere Bezeichnung
- SLC44A3 (SLC44A3 Produkte)
- Hintergrund
- SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.
- Molekulargewicht
- 68 kDa (MW of target protein)
-