SLC44A3 Antikörper (Middle Region)

Produktnummer ABIN635296

Produktdetails anti-SLC44A3 Antikörper

Target: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC44A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC44 A3 antibody was raised against the middle region of SLC44 3

Aufreinigung: Affinity purified

Immunogen: SLC44 A3 antibody was raised using the middle region of SLC44 3 corresponding to a region with amino acids TFAILIFFWVLWVAVLLSLGTAGAAQVMEGGQVEYKPLSGIRYMWSYHLI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC44A3 Blocking Peptide, catalog no. 33R-9061, is also available for use as a blocking control in assays to test for specificity of this SLC44A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC44A3

Target: SLC44A3 (Solute Carrier Family 44, Member 3 (SLC44A3))

Andere Bezeichnung: SLC44A3 (SLC44A3 Produkte)

Synonyme: CTL3 antikoerper, BC010552 antikoerper, RGD1305808 antikoerper, solute carrier family 44 member 3 antikoerper, solute carrier family 44, member 3 antikoerper, SLC44A3 antikoerper, slc44a3 antikoerper, Slc44a3 antikoerper

Hintergrund: SLC44A3 is a multi-pass membrane protein. It belongs to the CTL (choline transporter-like) family. The function of the RBM34 protein remains unknown.

Molekulargewicht: 68 kDa (MW of target protein)