FAM3C Antikörper (C-Term)

Produktnummer ABIN635303

Produktdetails anti-FAM3C Antikörper

Target: FAM3C (Family with Sequence Similarity 3, Member C (FAM3C))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM3C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM3 C antibody was raised against the C terminal of FAM3

Aufreinigung: Affinity purified

Immunogen: FAM3 C antibody was raised using the C terminal of FAM3 corresponding to a region with amino acids DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM3C Blocking Peptide, catalog no. 33R-2091, is also available for use as a blocking control in assays to test for specificity of this FAM3C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM3C

Target: FAM3C (Family with Sequence Similarity 3, Member C (FAM3C))

Andere Bezeichnung: FAM3C (FAM3C Produkte)

Synonyme: ILEI antikoerper, D6Wsu176e antikoerper, Ilei antikoerper, wu:fb99h11 antikoerper, wu:fi35h03 antikoerper, zgc:55444 antikoerper, zgc:77090 antikoerper, family with sequence similarity 3 member C antikoerper, family with sequence similarity 3, member C antikoerper, family with sequence similarity 3 member C L homeolog antikoerper, fam3c antikoerper, FAM3C antikoerper, Fam3c antikoerper, fam3c.L antikoerper

Hintergrund: FAM3C is a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.

Molekulargewicht: 22 kDa (MW of target protein)