ACBD5 Antikörper (N-Term)

Produktnummer ABIN635304

Produktdetails anti-ACBD5 Antikörper

Target: ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACBD5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACBD5 antibody was raised against the N terminal of ACBD5

Aufreinigung: Affinity purified

Immunogen: ACBD5 antibody was raised using the N terminal of ACBD5 corresponding to a region with amino acids ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACBD5 Blocking Peptide, catalog no. 33R-1108, is also available for use as a blocking control in assays to test for specificity of this ACBD5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACBD5

Target: ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))

Andere Bezeichnung: ACBD5 (ACBD5 Produkte)

Synonyme: MGC89100 antikoerper, 1300014E15Rik antikoerper, F15A18.90 antikoerper, F15A18_90 antikoerper, acyl-CoA binding protein 5 antikoerper, zgc:112043 antikoerper, acyl-CoA binding domain containing 5 antikoerper, acyl-CoA binding domain containing 5 L homeolog antikoerper, acyl-Coenzyme A binding domain containing 5 antikoerper, acyl-CoA binding protein 5 antikoerper, acyl-CoA binding domain containing 5a antikoerper, ACBD5 antikoerper, Acbd5 antikoerper, acbd5.L antikoerper, acbd5 antikoerper, ACBP5 antikoerper, acbd5a antikoerper

Hintergrund: ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.

Molekulargewicht: 55 kDa (MW of target protein)