ACBD5 Antikörper (C-Term)
-
- Target Alle ACBD5 Antikörper anzeigen
- ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACBD5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACBD5 antibody was raised against the C terminal of ACBD5
- Aufreinigung
- Affinity purified
- Immunogen
- ACBD5 antibody was raised using the C terminal of ACBD5 corresponding to a region with amino acids VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR
- Top Product
- Discover our top product ACBD5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACBD5 Blocking Peptide, catalog no. 33R-9785, is also available for use as a blocking control in assays to test for specificity of this ACBD5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACBD5 (Acyl-CoA Binding Domain Containing 5 (ACBD5))
- Andere Bezeichnung
- ACBD5 (ACBD5 Produkte)
- Synonyme
- MGC89100 antikoerper, 1300014E15Rik antikoerper, F15A18.90 antikoerper, F15A18_90 antikoerper, acyl-CoA binding protein 5 antikoerper, zgc:112043 antikoerper, acyl-CoA binding domain containing 5 antikoerper, acyl-CoA binding domain containing 5 L homeolog antikoerper, acyl-Coenzyme A binding domain containing 5 antikoerper, acyl-CoA binding protein 5 antikoerper, acyl-CoA binding domain containing 5a antikoerper, ACBD5 antikoerper, Acbd5 antikoerper, acbd5.L antikoerper, acbd5 antikoerper, ACBP5 antikoerper, acbd5a antikoerper
- Hintergrund
- ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known.
- Molekulargewicht
- 55 kDa (MW of target protein)
-