RRBP1 Antikörper
-
- Target Alle RRBP1 Antikörper anzeigen
- RRBP1 (Ribosome Binding Protein 1 (RRBP1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RRBP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RRBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TDVAQSPEAPKQEAPAKKKSGSKKKGPPDADGPLYLPYKTLVSTVGSMVF
- Top Product
- Discover our top product RRBP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RRBP1 Blocking Peptide, catalog no. 33R-9024, is also available for use as a blocking control in assays to test for specificity of this RRBP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRBP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RRBP1 (Ribosome Binding Protein 1 (RRBP1))
- Andere Bezeichnung
- RRBP1 (RRBP1 Produkte)
- Synonyme
- 1700087N07Rik antikoerper, 5730465C04Rik antikoerper, ES/130 antikoerper, mKIAA1398 antikoerper, mRRp0 antikoerper, mRRp1.8 antikoerper, mRRp10 antikoerper, mRRp15a antikoerper, mRRp15b antikoerper, mRRp16.8 antikoerper, mRRp2 antikoerper, mRRp41 antikoerper, mRRp47 antikoerper, mRRp5.4 antikoerper, p180 antikoerper, ES130 antikoerper, RRp antikoerper, hES antikoerper, P180 antikoerper, rrbp1 antikoerper, sb:cb489 antikoerper, wu:fc47a01 antikoerper, ribosome binding protein 1 antikoerper, ribosome binding protein 1 homolog 180kDa (dog) antikoerper, ribosome binding protein 1b antikoerper, Rrbp1 antikoerper, RRBP1 antikoerper, rrbp1b antikoerper
- Hintergrund
- Analysis of cDNA clones indicates that ribosome binding protein 1 may exist in different forms due to removal of tandem repeats, or partial intraexonic splicing of RRBP1. The form presented here is lacking the canine p180 ribosome-binding domain, NQGKKAEGAQ, which is tandemly repeated close to the N-terminus in other forms that haven't been fully characterized.
- Molekulargewicht
- 109 kDa (MW of target protein)
-