TMTC4 Antikörper (C-Term)

Produktnummer ABIN635307

Produktdetails anti-TMTC4 Antikörper

Target: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMTC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMTC4 antibody was raised against the C terminal of TMTC4

Aufreinigung: Affinity purified

Immunogen: TMTC4 antibody was raised using the C terminal of TMTC4 corresponding to a region with amino acids NDHSLMFSLANVLGKSQKYKESEALFLKAIKANPNAASYHGNLAVLYHRW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMTC4 Blocking Peptide, catalog no. 33R-6658, is also available for use as a blocking control in assays to test for specificity of this TMTC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMTC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMTC4

Target: TMTC4 (Transmembrane and Tetratricopeptide Repeat Containing 4 (TMTC4))

Andere Bezeichnung: TMTC4 (TMTC4 Produkte)

Synonyme: si:ch211-168k14.1 antikoerper, wu:fc58d04 antikoerper, 4930403J22Rik antikoerper, 5730419O14Rik antikoerper, RGD1560183 antikoerper, transmembrane and tetratricopeptide repeat containing 4 antikoerper, tmtc4 antikoerper, TMTC4 antikoerper, Tmtc4 antikoerper

Hintergrund: TMTC4 belongs to the TMTC family. Its exact function remains unknown.

Molekulargewicht: 83 kDa (MW of target protein)