TCTA Antikörper (Middle Region)

Produktnummer ABIN635313

Produktdetails anti-TCTA Antikörper

Target: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TCTA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TCTA antibody was raised against the middle region of TCTA

Aufreinigung: Affinity purified

Immunogen: TCTA antibody was raised using the middle region of TCTA corresponding to a region with amino acids IQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TCTA Blocking Peptide, catalog no. 33R-4114, is also available for use as a blocking control in assays to test for specificity of this TCTA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCTA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TCTA

Target: TCTA (T-Cell Leukemia Translocation Altered (TCTA))

Andere Bezeichnung: TCTA (TCTA Produkte)

Synonyme: PXYLT2 antikoerper, XT-II antikoerper, XT2 antikoerper, xylT-II antikoerper, 9130410M22Rik antikoerper, AW553637 antikoerper, C85065 antikoerper, Tctal antikoerper, wu:fb06g04 antikoerper, zgc:92721 antikoerper, xylosyltransferase 2 antikoerper, T-cell leukemia translocation altered antikoerper, T cell leukemia translocation altered gene antikoerper, T-cell leukemia translocation altered S homeolog antikoerper, T-cell leukemia translocation altered gene antikoerper, XYLT2 antikoerper, TCTA antikoerper, Tcta antikoerper, tcta.S antikoerper, tcta antikoerper

Hintergrund: A chromosomal aberration, translocation t(1,3)(p34,p21), involving TCTA is associated with T-cell acute lymphoblastic leukemia (T-ALL).

Molekulargewicht: 11 kDa (MW of target protein)