ACBD4 Antikörper (N-Term)
-
- Target Alle ACBD4 Antikörper anzeigen
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACBD4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACBD4 antibody was raised against the N terminal of ACBD4
- Aufreinigung
- Affinity purified
- Immunogen
- ACBD4 antibody was raised using the N terminal of ACBD4 corresponding to a region with amino acids NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI
- Top Product
- Discover our top product ACBD4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACBD4 Blocking Peptide, catalog no. 33R-6881, is also available for use as a blocking control in assays to test for specificity of this ACBD4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACBD4 (Acyl-CoA Binding Domain Containing 4 (ACBD4))
- Andere Bezeichnung
- ACBD4 (ACBD4 Produkte)
- Synonyme
- zgc:85611 antikoerper, F22F7.13 antikoerper, F22F7_13 antikoerper, acyl-CoA binding protein 4 antikoerper, 2010009P05Rik antikoerper, 2010015A21Rik antikoerper, AI849317 antikoerper, acyl-CoA binding domain containing 4 antikoerper, acyl-CoA binding protein 4 antikoerper, acyl-Coenzyme A binding domain containing 4 antikoerper, ACBD4 antikoerper, acbd4 antikoerper, Acbd4 antikoerper, ACBP4 antikoerper
- Hintergrund
- ACBD4 is a member of the acyl-coenzyme A binding domain containing protein family. All family members contain the conserved acyl-Coenzyme A binding domain, which binds acyl-CoA thiol esters. They are thought to play roles in acyl-CoA dependent lipid metabolism.
- Molekulargewicht
- 35 kDa (MW of target protein)
-