ABCB1 Antikörper
-
- Target Alle ABCB1 Antikörper anzeigen
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABCB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ABCB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ
- Top Product
- Discover our top product ABCB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABCB1 Blocking Peptide, catalog no. 33R-1285, is also available for use as a blocking control in assays to test for specificity of this ABCB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABCB1 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 1 (ABCB1))
- Andere Bezeichnung
- ABCB1 (ABCB1 Produkte)
- Synonyme
- ABC20 antikoerper, CD243 antikoerper, CLCS antikoerper, GP170 antikoerper, MDR1 antikoerper, P-GP antikoerper, PGY1 antikoerper, Abcb1 antikoerper, Mdr1a antikoerper, p-gp antikoerper, xemdr antikoerper, Mdr1 antikoerper, Mdr1b antikoerper, Pgy-1 antikoerper, Pgy1 antikoerper, mdr antikoerper, ABCB1 antikoerper, PGP1 antikoerper, ATP binding cassette subfamily B member 1 antikoerper, ATP binding cassette subfamily B member 1A antikoerper, ATP binding cassette subfamily B member 1 L homeolog antikoerper, ATP-binding cassette, sub-family B (MDR/TAP), member 1B antikoerper, ABCB1 antikoerper, Abcb1a antikoerper, abcb1.L antikoerper, Abcb1b antikoerper, Abcb1 antikoerper
- Hintergrund
- The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes.
- Molekulargewicht
- 141 kDa (MW of target protein)
-