SLC35E2 Antikörper (Middle Region)
-
- Target Alle SLC35E2 Antikörper anzeigen
- SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC35E2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC35 E2 antibody was raised against the middle region of SLC35 2
- Aufreinigung
- Affinity purified
- Immunogen
- SLC35 E2 antibody was raised using the middle region of SLC35 2 corresponding to a region with amino acids AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP
- Top Product
- Discover our top product SLC35E2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC35E2 Blocking Peptide, catalog no. 33R-1007, is also available for use as a blocking control in assays to test for specificity of this SLC35E2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC35E2 (Solute Carrier Family 35, Member E2 (SLC35E2))
- Andere Bezeichnung
- SLC35E2 (SLC35E2 Produkte)
- Synonyme
- Slc35e2 antikoerper, SLC35E2 antikoerper, A530082C11Rik antikoerper, AI957035 antikoerper, solute carrier family 35, member E2B antikoerper, solute carrier family 35 member E2B antikoerper, solute carrier family 35 member E3 antikoerper, solute carrier family 35 member E2 antikoerper, solute carrier family 35, member E2 antikoerper, Slc35e2b antikoerper, SLC35E2B antikoerper, SLC35E3 antikoerper, SLC35E2 antikoerper, Slc35e2 antikoerper
- Hintergrund
- SLC35E2 is a putative transporter.
- Molekulargewicht
- 29 kDa (MW of target protein)
-