TM4SF20 Antikörper (Middle Region)

Produktnummer ABIN635333

Produktdetails anti-TM4SF20 Antikörper

Target: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TM4SF20 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TM4 SF20 antibody was raised against the middle region of TM4 F20

Aufreinigung: Affinity purified

Immunogen: TM4 SF20 antibody was raised using the middle region of TM4 F20 corresponding to a region with amino acids QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TM4SF20 Blocking Peptide, catalog no. 33R-7465, is also available for use as a blocking control in assays to test for specificity of this TM4SF20 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TM4SF20

Target: TM4SF20 (Transmembrane 4 L Six Family Member 20 (TM4SF20))

Andere Bezeichnung: TM4SF20 (TM4SF20 Produkte)

Synonyme: pro994 antikoerper, tcce518 antikoerper, PRO994 antikoerper, TCCE518 antikoerper, 1810018L02Rik antikoerper, transmembrane 4 L six family member 20 antikoerper, transmembrane 4 L six family member 20 L homeolog antikoerper, TM4SF20 antikoerper, Tm4sf20 antikoerper, tm4sf20.L antikoerper, tm4sf20 antikoerper

Hintergrund: TM4SF20 functions as a cellular component of the plasma membrane.

Molekulargewicht: 25 kDa (MW of target protein)