Calsyntenin 1 Antikörper (N-Term)
-
- Target Alle Calsyntenin 1 (CLSTN1) Antikörper anzeigen
- Calsyntenin 1 (CLSTN1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Calsyntenin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Calsyntenin 1 antibody was raised against the N terminal of CLSTN1
- Aufreinigung
- Affinity purified
- Immunogen
- Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI
- Top Product
- Discover our top product CLSTN1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Calsyntenin 1 Blocking Peptide, catalog no. 33R-4599, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLSTN1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Calsyntenin 1 (CLSTN1)
- Andere Bezeichnung
- Calsyntenin 1 (CLSTN1 Produkte)
- Synonyme
- CALSYNTENIN-1 antikoerper, fm67g03 antikoerper, wu:fk52g02 antikoerper, wu:fm67g03 antikoerper, zgc:153744 antikoerper, zgc:56528 antikoerper, clstn1 antikoerper, 1810034E21Rik antikoerper, Cst-1 antikoerper, Cstn1 antikoerper, ALC-ALPHA antikoerper, CDHR12 antikoerper, CSTN1 antikoerper, PIK3CD antikoerper, XB31alpha antikoerper, alcalpha1 antikoerper, alcalpha2 antikoerper, calsyntenin 1 antikoerper, calsyntenin 3 antikoerper, beta-catenin-interacting protein 1 antikoerper, calsyntenin-1 antikoerper, CLSTN1 antikoerper, clstn1 antikoerper, clstn3 antikoerper, LOC100356725 antikoerper, LOC100435584 antikoerper, Clstn1 antikoerper, LOC479600 antikoerper
- Hintergrund
- CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.
- Molekulargewicht
- 110 kDa (MW of target protein)
-