AWAT1 Antikörper (N-Term)

Produktnummer ABIN635354

Produktdetails anti-AWAT1 Antikörper

Target: AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AWAT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AWAT1 antibody was raised against the N terminal of AWAT1

Aufreinigung: Affinity purified

Immunogen: AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AWAT1 Blocking Peptide, catalog no. 33R-6931, is also available for use as a blocking control in assays to test for specificity of this AWAT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AWAT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AWAT1

Target: AWAT1 (Acyl-CoA Wax Alcohol Acyltransferase 1 (AWAT1))

Andere Bezeichnung: AWAT1 (AWAT1 Produkte)

Synonyme: DGAT2L3 antikoerper, Dgat2l3 antikoerper, dga2 antikoerper, dgat2l3 antikoerper, DGA2 antikoerper, acyl-CoA wax alcohol acyltransferase 1 antikoerper, acyl-CoA wax alcohol acyltransferase 1 L homeolog antikoerper, AWAT1 antikoerper, Awat1 antikoerper, awat1.L antikoerper, awat1 antikoerper

Hintergrund: The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.

Molekulargewicht: 38 kDa (MW of target protein)