ABHD12 Antikörper (Middle Region)
-
- Target Alle ABHD12 Antikörper anzeigen
- ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ABHD12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ABHD12 antibody was raised against the middle region of ABHD12
- Aufreinigung
- Affinity purified
- Immunogen
- ABHD12 antibody was raised using the middle region of ABHD12 corresponding to a region with amino acids CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH
- Top Product
- Discover our top product ABHD12 Primärantikörper
-
anti-Abhydrolase Domain Containing 12 (ABHD12) (AA 40-66), (N-Term) antibody
ABHD12 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB22386 unconjugated
anti-Abhydrolase Domain Containing 12 (ABHD12) antibodyABHD12 Reaktivität: Human, Maus, Ratte WB, ELISA, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Abhydrolase Domain Containing 12 (ABHD12) antibodyABHD12 Reaktivität: Human, Maus WB, IHC, FACS Wirt: Kaninchen Polyclonal unconjugated
anti-Abhydrolase Domain Containing 12 (ABHD12) (Internal Region) antibodyABHD12 Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Abhydrolase Domain Containing 12 (ABHD12) (Internal Region) antibodyABHD12 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Abhydrolase Domain Containing 12 (ABHD12) (AA 1-404) antibodyABHD12 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Abhydrolase Domain Containing 12 (ABHD12) (AA 110-250) antibodyABHD12 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Abhydrolase Domain Containing 12 (ABHD12) (C-Term) antibodyVerified ABHD12 Reaktivität: Maus, Ratte WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-Abhydrolase Domain Containing 12 (ABHD12) (AA 323-372) antibodyABHD12 Reaktivität: Human, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Meerschweinchen, Affe WB Wirt: Kaninchen Polyclonal unconjugated
anti-Abhydrolase Domain Containing 12 (ABHD12) (C-Term) antibodyABHD12 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Kaninchen, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ABHD12 Blocking Peptide, catalog no. 33R-1766, is also available for use as a blocking control in assays to test for specificity of this ABHD12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABHD12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ABHD12 (Abhydrolase Domain Containing 12 (ABHD12))
- Andere Bezeichnung
- ABHD12 (ABHD12 Produkte)
- Synonyme
- ABHD12 antikoerper, 1500011G07Rik antikoerper, 6330583M11Rik antikoerper, AI431047 antikoerper, AW547313 antikoerper, ABHD12A antikoerper, BEM46L2 antikoerper, C20orf22 antikoerper, PHARC antikoerper, dJ965G21.2 antikoerper, abhydrolase domain containing 12 antikoerper, abhydrolase domain containing 12 S homeolog antikoerper, ABHD12 antikoerper, CC1G_02966 antikoerper, PTRG_02160 antikoerper, abhd12.S antikoerper, Abhd12 antikoerper
- Hintergrund
- ABHD12 may be a regulator of endocannabinoid signaling pathways.
- Molekulargewicht
- 45 kDa (MW of target protein)
-
