SLC33A1 Antikörper
-
- Target Alle SLC33A1 Antikörper anzeigen
- SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC33A1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC33 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CNSVGQTAGYFLGNVLFLALESADFCNKYLRFQPQPRGIVTLSDFLFFWG
- Top Product
- Discover our top product SLC33A1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC33A1 Blocking Peptide, catalog no. 33R-1757, is also available for use as a blocking control in assays to test for specificity of this SLC33A1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC33A1 (Solute Carrier Family 33 Member 1 (SLC33A1))
- Andere Bezeichnung
- SLC33A1 (SLC33A1 Produkte)
- Synonyme
- zgc:63693 antikoerper, ACATN antikoerper, AT-1 antikoerper, AT1 antikoerper, CCHLND antikoerper, SPG42 antikoerper, AI315656 antikoerper, AI788741 antikoerper, Acatn antikoerper, D630022N01Rik antikoerper, solute carrier family 33 (acetyl-CoA transporter), member 1 antikoerper, solute carrier family 33 member 1 antikoerper, slc33a1 antikoerper, SLC33A1 antikoerper, Slc33a1 antikoerper
- Hintergrund
- SLC33A1 is required for the formation of O-acetylated (Ac) gangliosides. It is predicted to contain 6 to 10 transmembrane domains, and a leucine zipper motif in transmembrane domain III. Studies indicate that the protein is localized to the cytoplasm.
- Molekulargewicht
- 61 kDa (MW of target protein)
-