Slc38a5 Antikörper (N-Term)
-
- Target Alle Slc38a5 Antikörper anzeigen
- Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Slc38a5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SLC38 A5 antibody was raised against the N terminal of SLC38 5
- Aufreinigung
- Affinity purified
- Immunogen
- SLC38 A5 antibody was raised using the N terminal of SLC38 5 corresponding to a region with amino acids GIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSELPLVIGT
- Top Product
- Discover our top product Slc38a5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC38A5 Blocking Peptide, catalog no. 33R-3343, is also available for use as a blocking control in assays to test for specificity of this SLC38A5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Slc38a5 (Solute Carrier Family 38, Member 5 (Slc38a5))
- Andere Bezeichnung
- SLC38A5 (Slc38a5 Produkte)
- Synonyme
- MGC80848 antikoerper, slc38a3 antikoerper, SN2 antikoerper, JM24 antikoerper, SNAT5 antikoerper, pp7194 antikoerper, C81234 antikoerper, E330031E14 antikoerper, solute carrier family 38 member 5 S homeolog antikoerper, solute carrier family 38 member 5 antikoerper, solute carrier family 38, member 5 antikoerper, slc38a5.S antikoerper, SLC38A5 antikoerper, slc38a5 antikoerper, Slc38a5 antikoerper
- Hintergrund
- The protein encoded by this gene is a system N sodium-coupled amino acid transporter involved in the transfer of glutamine, asparagine, histidine, serine, alanine, and glycine.
- Molekulargewicht
- 51 kDa (MW of target protein)
-