SLC35F3 Antikörper (Middle Region)

Produktnummer ABIN635380

Produktdetails anti-SLC35F3 Antikörper

Target: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC35F3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC35 F3 antibody was raised against the middle region of SLC35 3

Aufreinigung: Affinity purified

Immunogen: SLC35 F3 antibody was raised using the middle region of SLC35 3 corresponding to a region with amino acids LKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC35F3 Blocking Peptide, catalog no. 33R-5111, is also available for use as a blocking control in assays to test for specificity of this SLC35F3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC35F3

Target: SLC35F3 (Solute Carrier Family 35, Member F3 (SLC35F3))

Andere Bezeichnung: SLC35F3 (SLC35F3 Produkte)

Synonyme: B230375D17Rik antikoerper, slc35f3 antikoerper, zgc:171853 antikoerper, solute carrier family 35 member F3 antikoerper, putative thiamine transporter SLC35F3 antikoerper, solute carrier family 35, member F3 antikoerper, solute carrier family 35, member F3a antikoerper, SLC35F3 antikoerper, LOC718789 antikoerper, Slc35f3 antikoerper, slc35f3a antikoerper

Hintergrund: SLC35F3 is a multi-pass membrane proteinPotential. It belongs to the SLC35F solute transporter family. SLC35F3 is a putative solute transporter.

Molekulargewicht: 55 kDa (MW of target protein)