TMEM200B Antikörper (N-Term)
-
- Target Alle TMEM200B Produkte
- TMEM200B (Transmembrane Protein 200B (TMEM200B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM200B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TTMB antibody was raised against the N terminal Of Ttmb
- Aufreinigung
- Affinity purified
- Immunogen
- TTMB antibody was raised using the N terminal Of Ttmb corresponding to a region with amino acids AGYWPHRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVI
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TTMB Blocking Peptide, catalog no. 33R-1238, is also available for use as a blocking control in assays to test for specificity of this TTMB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTMB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM200B (Transmembrane Protein 200B (TMEM200B))
- Andere Bezeichnung
- TTMB (TMEM200B Produkte)
- Synonyme
- TTMB antikoerper, EG623230 antikoerper, transmembrane protein 200B antikoerper, TMEM200B antikoerper, Tmem200b antikoerper
- Hintergrund
- TTMB is a multi-pass membrane protein. It belongs to the TMEM200 family. The function of the TTMB protein remains unknown.
- Molekulargewicht
- 33 kDa (MW of target protein)
-