TTYH1 Antikörper
-
- Target Alle TTYH1 Antikörper anzeigen
- TTYH1 (Tweety Homolog 1 (TTYH1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TTYH1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- TTYH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA
- Top Product
- Discover our top product TTYH1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TTYH1 Blocking Peptide, catalog no. 33R-3168, is also available for use as a blocking control in assays to test for specificity of this TTYH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TTYH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TTYH1 (Tweety Homolog 1 (TTYH1))
- Andere Bezeichnung
- TTYH1 (TTYH1 Produkte)
- Synonyme
- 4930459B04Rik antikoerper, 6330408P11Rik antikoerper, tty antikoerper, TTYH1 antikoerper, ttyh1-A antikoerper, tweety family member 1 antikoerper, tweety family member 1 L homeolog antikoerper, Protein tweety homolog 1 antikoerper, Ttyh1 antikoerper, TTYH1 antikoerper, ttyh1.L antikoerper, ttyh-1 antikoerper
- Hintergrund
- TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.
- Molekulargewicht
- 49 kDa (MW of target protein)
-