Podoplanin Antikörper (N-Term)
-
- Target Alle Podoplanin (PDPN) Antikörper anzeigen
- Podoplanin (PDPN)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Podoplanin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- Podoplanin antibody was raised against the N terminal of PDPN
- Aufreinigung
- Affinity purified
- Immunogen
- Podoplanin antibody was raised using the N terminal of PDPN corresponding to a region with amino acids EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT
- Top Product
- Discover our top product PDPN Primärantikörper
-
anti-Podoplanin (PDPN) (AA 91-166) antibody
PDPN Reaktivität: Maus, Ratte WB, IHC (p), IHC (fro), IF (p), IF (cc) Wirt: Kaninchen Polyclonal unconjugated
anti-Podoplanin (PDPN) (AA 23-143) antibodyPDPN Reaktivität: Human WB, IHC, IP, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Podoplanin (PDPN) (AA 24-126) antibodyPDPN Reaktivität: Human ELISA, IF, IHC (f), Coat Wirt: Maus Monoclonal PDPN-1433 unconjugated
anti-Podoplanin (PDPN) antibodyPDPN Reaktivität: Maus WB, FACS, IP, IHC (p) Wirt: Ratte Monoclonal 8F11 unconjugated
anti-Podoplanin (PDPN) antibodyPDPN Reaktivität: Human WB, IHC, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Podoplanin (PDPN) (AA 1-100) antibodyPDPN Reaktivität: Synthetic ELISA, IF, IHC (f), Coat Wirt: Kaninchen Monoclonal unconjugated Recombinant Antibody
anti-Podoplanin (PDPN) antibodyPDPN Reaktivität: Human, Maus WB, ELISA Wirt: Maus Monoclonal 5-00E-02 unconjugated
anti-Podoplanin (PDPN) (N-Term) antibodyPDPN Reaktivität: Human, Maus WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Podoplanin (PDPN) antibodyPDPN Reaktivität: Maus WB, IP, IHC (fro) Wirt: Golden Syrian Hamster Monoclonal 811 unconjugated
anti-Podoplanin (PDPN) (AA 97-146) antibodyPDPN Reaktivität: Human, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Podoplanin Blocking Peptide, catalog no. 33R-2420, is also available for use as a blocking control in assays to test for specificity of this Podoplanin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDPN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Podoplanin (PDPN)
- Andere Bezeichnung
- Podoplanin (PDPN Produkte)
- Synonyme
- PDPN antikoerper, AGGRUS antikoerper, GP36 antikoerper, GP40 antikoerper, Gp38 antikoerper, HT1A-1 antikoerper, OTS8 antikoerper, PA2.26 antikoerper, T1A antikoerper, T1A-2 antikoerper, OTS-8 antikoerper, RANDAM-2 antikoerper, T1-alpha antikoerper, T1a antikoerper, T1alpha antikoerper, E11 antikoerper, RTI40 antikoerper, podoplanin antikoerper, PDPN antikoerper, Pdpn antikoerper
- Hintergrund
- PDPN is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-
