NIPA2 Antikörper (Middle Region)

Produktnummer ABIN635392

Produktdetails anti-NIPA2 Antikörper

Target: NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NIPA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NIPA2 antibody was raised against the middle region of NIPA2

Aufreinigung: Affinity purified

Immunogen: NIPA2 antibody was raised using the middle region of NIPA2 corresponding to a region with amino acids VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NIPA2 Blocking Peptide, catalog no. 33R-9920, is also available for use as a blocking control in assays to test for specificity of this NIPA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIPA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NIPA2

Target: NIPA2 (Non Imprinted in Prader-Willi/Angelman Syndrome 2 (NIPA2))

Andere Bezeichnung: NIPA2 (NIPA2 Produkte)

Synonyme: RGD1306051 antikoerper, fb72g02 antikoerper, wu:fb72g02 antikoerper, zgc:66088 antikoerper, 2600017P10Rik antikoerper, 3830408P04Rik antikoerper, AB041581 antikoerper, non imprinted in Prader-Willi/Angelman syndrome 2 antikoerper, non imprinted in Prader-Willi/Angelman syndrome 2 (human) antikoerper, non imprinted in Prader-Willi/Angelman syndrome 2 homolog (human) antikoerper, NIPA2 antikoerper, Nipa2 antikoerper, nipa2 antikoerper

Hintergrund: NIPA2 belongs to the NIPA family. It is a multi-pass membrane protein. The function of the NIPA2 protein remains unknown.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization