ITPRIPL1 Antikörper (C-Term)

Produktnummer ABIN635393

Produktdetails anti-ITPRIPL1 Antikörper

Target: ITPRIPL1 (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITPRIPL1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIAA1754 L antibody was raised against the C terminal of KIAA1754

Aufreinigung: Affinity purified

Immunogen: KIAA1754 L antibody was raised using the C terminal of KIAA1754 corresponding to a region with amino acids EHLFLKLVGRFAPENTCHLKCLQIILSLRQHQSLPHGASRPILTSYHFKT

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIAA1754L Blocking Peptide, catalog no. 33R-2453, is also available for use as a blocking control in assays to test for specificity of this KIAA1754L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA1750 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITPRIPL1

Target: ITPRIPL1 (Inositol 1,4,5-Triphosphate Receptor Interacting Protein-Like 1 (ITPRIPL1))

Andere Bezeichnung: KIAA1754L (ITPRIPL1 Produkte)

Synonyme: 1700041B20Rik antikoerper, KIAA1754L antikoerper, inositol 1,4,5-triphosphate receptor interacting protein-like 1 antikoerper, ITPRIP like 1 antikoerper, inositol 1,4,5-trisphosphate receptor interacting protein-like 1 antikoerper, Itpripl1 antikoerper, ITPRIPL1 antikoerper

Hintergrund: The function of KIAA1754L protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 61 kDa (MW of target protein)