C1orf151 Antikörper (Middle Region)
-
- Target Alle C1orf151 Antikörper anzeigen
- C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Maus, Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C1orf151 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C1 ORF151 antibody was raised against the middle region of C1 rf151
- Aufreinigung
- Affinity purified
- Immunogen
- C1 ORF151 antibody was raised using the middle region of C1 rf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ
- Top Product
- Discover our top product C1orf151 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C1ORF151 Blocking Peptide, catalog no. 33R-4197, is also available for use as a blocking control in assays to test for specificity of this C1ORF151 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF151 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))
- Andere Bezeichnung
- C1ORF151 (C1orf151 Produkte)
- Hintergrund
- The function of C1orf151 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 9 kDa (MW of target protein)
-