C1orf151 Antikörper (Middle Region)

Produktnummer ABIN635405

Produktdetails anti-C1orf151 Antikörper

Target: C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C1orf151 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C1 ORF151 antibody was raised against the middle region of C1 rf151

Aufreinigung: Affinity purified

Immunogen: C1 ORF151 antibody was raised using the middle region of C1 rf151 corresponding to a region with amino acids IVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C1ORF151 Blocking Peptide, catalog no. 33R-4197, is also available for use as a blocking control in assays to test for specificity of this C1ORF151 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF151 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C1orf151

Target: C1orf151 (Chromosome 1 Open Reading Frame 151 (C1orf151))

Andere Bezeichnung: C1ORF151 (C1orf151 Produkte)

Synonyme: C1orf151 antikoerper, MIO10 antikoerper, RGD1560187 antikoerper, 2310028O11Rik antikoerper, mitochondrial inner membrane organizing system 1 antikoerper, MINOS1 antikoerper, Minos1 antikoerper

Hintergrund: The function of C1orf151 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 9 kDa (MW of target protein)