ART3 Antikörper (Middle Region)
-
- Target Alle ART3 Antikörper anzeigen
- ART3 (ADP-Ribosyltransferase 3 (ART3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ART3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ART3 antibody was raised against the middle region of ART3
- Aufreinigung
- Affinity purified
- Immunogen
- ART3 antibody was raised using the middle region of ART3 corresponding to a region with amino acids LEPTQIPAPGPVPVPGPKSHPSASSGKLLLPQFGMVIILISVSAINLFVA
- Top Product
- Discover our top product ART3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ART3 Blocking Peptide, catalog no. 33R-4921, is also available for use as a blocking control in assays to test for specificity of this ART3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ART3 (ADP-Ribosyltransferase 3 (ART3))
- Andere Bezeichnung
- ART3 (ART3 Produkte)
- Synonyme
- ARTC3 antikoerper, 4930569O04Rik antikoerper, ART3 antikoerper, DKFZp468P1925 antikoerper, ADP-ribosyltransferase 3 antikoerper, ART3 antikoerper, Art3 antikoerper
- Hintergrund
- ADP-ribosylation is a reversible posttranslational modification used to regulate protein function.
- Molekulargewicht
- 40 kDa (MW of target protein)
-