Integrin beta 5 Antikörper (Middle Region)
-
- Target Alle Integrin beta 5 (ITGB5) Antikörper anzeigen
- Integrin beta 5 (ITGB5)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Integrin beta 5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Integrin Beta 5 antibody was raised against the middle region of ITGB5
- Aufreinigung
- Affinity purified
- Immunogen
- Integrin Beta 5 antibody was raised using the middle region of ITGB5 corresponding to a region with amino acids LFFTATCQDGVSYPGQRKCEGLKIGDTASFEVSLEARSCPSRHTEHVFAL
- Top Product
- Discover our top product ITGB5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Integrin Beta 5 Blocking Peptide, catalog no. 33R-4936, is also available for use as a blocking control in assays to test for specificity of this Integrin Beta 5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGB5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Integrin beta 5 (ITGB5)
- Andere Bezeichnung
- Integrin beta 5 (ITGB5 Produkte)
- Synonyme
- ITGB5 antikoerper, AA475909 antikoerper, AI874634 antikoerper, ESTM23 antikoerper, [b]-5 antikoerper, [b]5 antikoerper, [b]5A antikoerper, [b]5B antikoerper, beta-5 antikoerper, beta5 antikoerper, RGD1563276 antikoerper, integrin, beta 5 antikoerper, integrin beta 5 antikoerper, integrin subunit beta 5 antikoerper, ITGB5 antikoerper, Itgb5 antikoerper
- Hintergrund
- Integrin alpha-V/beta-5 is a receptor for fibronectin. It recognises the sequence R-G-D in its ligand.
- Molekulargewicht
- 88 kDa (MW of target protein)
- Pathways
- Integrin Complex
-