Ribophorin II Antikörper (Middle Region)
-
- Target Alle Ribophorin II (RPN2) Antikörper anzeigen
- Ribophorin II (RPN2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Ribophorin II Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Ribophorin II antibody was raised against the middle region of RPN2
- Aufreinigung
- Affinity purified
- Immunogen
- Ribophorin II antibody was raised using the middle region of RPN2 corresponding to a region with amino acids IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSP
- Top Product
- Discover our top product RPN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Ribophorin II Blocking Peptide, catalog no. 33R-4018, is also available for use as a blocking control in assays to test for specificity of this Ribophorin II antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPN2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Ribophorin II (RPN2)
- Andere Bezeichnung
- Ribophorin II (RPN2 Produkte)
- Synonyme
- RIBIIR antikoerper, RPN-II antikoerper, RPNII antikoerper, SWP1 antikoerper, RPN2 antikoerper, 1300012C06Rik antikoerper, AV261018 antikoerper, Rpn-2 antikoerper, fb95d11 antikoerper, fj62b10 antikoerper, wu:fb61f08 antikoerper, wu:fb74e07 antikoerper, wu:fb95d11 antikoerper, wu:fj41f11 antikoerper, wu:fj62b10 antikoerper, rpn2 antikoerper, ribophorin II antikoerper, dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 antikoerper, ribophorin II S homeolog antikoerper, RPN2 antikoerper, Rpn2 antikoerper, rpn2 antikoerper, LOC5579328 antikoerper, Bm1_30625 antikoerper, rpn2.S antikoerper
- Hintergrund
- RPN2 is a type I integral membrane protein found only in the rough endoplasmic reticulum.
- Molekulargewicht
- 67 kDa (MW of target protein)
-