ITGA8 Antikörper (N-Term)

Produktnummer ABIN635422

Produktdetails anti-ITGA8 Antikörper

Target: ITGA8 (Integrin alpha-8 (ITGA8))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ITGA8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Integrin Alpha 8 antibody was raised against the N terminal of ITGA8

Aufreinigung: Affinity purified

Immunogen: Integrin Alpha 8 antibody was raised using the N terminal of ITGA8 corresponding to a region with amino acids GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Integrin Alpha 8 Blocking Peptide, catalog no. 33R-3233, is also available for use as a blocking control in assays to test for specificity of this Integrin Alpha 8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ITGA8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ITGA8

Target: ITGA8 (Integrin alpha-8 (ITGA8))

Andere Bezeichnung: Integrin alpha 8 (ITGA8 Produkte)

Synonyme: AI447669 antikoerper, RGD1564327 antikoerper, integrin alpha 8 antikoerper, integrin subunit alpha 8 antikoerper, Itga8 antikoerper, ITGA8 antikoerper

Hintergrund: Integrin alpha-8/beta-1 functions in the genesis of kidney and probably of other organs by regulating the recruitment of mesenchymal cells into epithelial structures.

Molekulargewicht: 117 kDa (MW of target protein)