DEGS1 Antikörper
-
- Target Alle DEGS1 Antikörper anzeigen
- DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DEGS1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DEGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV
- Top Product
- Discover our top product DEGS1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DEGS1 Blocking Peptide, catalog no. 33R-3584, is also available for use as a blocking control in assays to test for specificity of this DEGS1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DEGS1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))
- Andere Bezeichnung
- DEGS1 (DEGS1 Produkte)
- Hintergrund
- DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.
- Molekulargewicht
- 38 kDa (MW of target protein)
-