DEGS1 Antikörper

Produktnummer ABIN635423

Produktdetails anti-DEGS1 Antikörper

Target: DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DEGS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DEGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DEGS1 Blocking Peptide, catalog no. 33R-3584, is also available for use as a blocking control in assays to test for specificity of this DEGS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DEGS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DEGS1

Target: DEGS1 (Sphingolipid Delta(4)-Desaturase DES1 (DEGS1))

Andere Bezeichnung: DEGS1 (DEGS1 Produkte)

Synonyme: DEGS antikoerper, DEGS-1 antikoerper, DES1 antikoerper, Des-1 antikoerper, FADS7 antikoerper, MLD antikoerper, degs antikoerper, im:6909319 antikoerper, wu:fa25h01 antikoerper, wu:fb81d06 antikoerper, Degs antikoerper, AA536663 antikoerper, Des1 antikoerper, Mdes antikoerper, delta 4-desaturase, sphingolipid 1 antikoerper, delta(4)-desaturase, sphingolipid 1 antikoerper, DEGS1 antikoerper, degs1 antikoerper, Degs1 antikoerper

Hintergrund: DEGS1 is a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this protein inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.

Molekulargewicht: 38 kDa (MW of target protein)