CHST2 Antikörper

Produktnummer ABIN635427

Produktdetails anti-CHST2 Antikörper

Target: CHST2 (Carbohydrate (N-Acetylglucosamine-6-O) Sulfotransferase 2 (CHST2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHST2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CHST2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHST2 Blocking Peptide, catalog no. 33R-6649, is also available for use as a blocking control in assays to test for specificity of this CHST2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHST2

Target: CHST2 (Carbohydrate (N-Acetylglucosamine-6-O) Sulfotransferase 2 (CHST2))

Andere Bezeichnung: CHST2 (CHST2 Produkte)

Hintergrund: N-acetylglucosamine-6-O-sulfotransferases, such as CHST2, catalyze the transfer of sulfate from 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) to position 6 of a nonreducing N-acetylglucosamine (GlcNAc) residue.

Molekulargewicht: 58 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process