Golgin B1 (GOLGB1) (N-Term) Antikörper
-
- Target Alle Golgin B1 (GOLGB1) Antikörper anzeigen
- Golgin B1 (GOLGB1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GOLGB1 antibody was raised against the N terminal of GOLGB1
- Aufreinigung
- Affinity purified
- Immunogen
- GOLGB1 antibody was raised using the N terminal of GOLGB1 corresponding to a region with amino acids NKYIEEMKAQGGTVLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKE
- Top Product
- Discover our top product GOLGB1 Primärantikörper
-
anti-Golgin B1 (GOLGB1) (AA 751-850) antibody
GOLGB1 Reaktivität: Human, Maus, Ratte WB, ELISA, FACS, IF (cc), IF (p), ICC, IHC (fro), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin B1 (GOLGB1) antibodyGOLGB1 Reaktivität: Maus, Ratte WB, IHC, ICC Wirt: Meerschweinchen Polyclonal unconjugated
anti-Golgin B1 (GOLGB1) (AA 1764-1869) antibodyGOLGB1 Reaktivität: Human ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Golgin B1 (GOLGB1) (AA 3-91) antibodyGOLGB1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 6D4 unconjugated
anti-Golgin B1 (GOLGB1) (AA 751-850) antibody (AbBy Fluor® 488)GOLGB1 Reaktivität: Human, Maus, Ratte WB, FACS, IF (cc), IF (p) Wirt: Kaninchen Polyclonal AbBy Fluor® 488
anti-Golgin B1 (GOLGB1) antibodyGOLGB1 Reaktivität: Human DB Wirt: Maus Monoclonal 2388C3a unconjugated
anti-Golgin B1 (GOLGB1) (N-Term) antibodyGOLGB1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Pferd, Schwein, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GOLGB1 Blocking Peptide, catalog no. 33R-6750, is also available for use as a blocking control in assays to test for specificity of this GOLGB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GOLGB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Golgin B1 (GOLGB1)
- Andere Bezeichnung
- GOLGB1 (GOLGB1 Produkte)
- Synonyme
- gcp antikoerper, golim1 antikoerper, giantin antikoerper, 4930428L02Rik antikoerper, 628101 antikoerper, 6330407A06Rik antikoerper, AU042952 antikoerper, C130074L01Rik antikoerper, F730017E11Rik antikoerper, Gm6840 antikoerper, mKIAA4151 antikoerper, GCP antikoerper, GCP372 antikoerper, GOLIM1 antikoerper, golgin B1 antikoerper, golgin B1 S homeolog antikoerper, golgi autoantigen, golgin subfamily b, macrogolgin 1 antikoerper, GOLGB1 antikoerper, golgb1.S antikoerper, Golgb1 antikoerper
- Hintergrund
- GOLGB1 may participate in forming intercisternal cross-bridges of the Golgi complex.
- Molekulargewicht
- 376 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-
