LARGE Antikörper (Middle Region)

Produktnummer ABIN635429

Produktdetails anti-LARGE Antikörper

Target: LARGE (Like-Glycosyltransferase (LARGE))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LARGE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LARGE antibody was raised against the middle region of LARGE

Aufreinigung: Affinity purified

Immunogen: LARGE antibody was raised using the middle region of LARGE corresponding to a region with amino acids AHIMELDVQEYEFIVLPNAYMIHMPHAPSFDITKFRSNKQYRICLKTLKE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LARGE Blocking Peptide, catalog no. 33R-1247, is also available for use as a blocking control in assays to test for specificity of this LARGE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARGE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LARGE

Target: LARGE (Like-Glycosyltransferase (LARGE))

Andere Bezeichnung: LARGE (LARGE Produkte)

Synonyme: gyltl1b antikoerper, gyltl1b-b antikoerper, mdc1d antikoerper, MDC1D antikoerper, MDDGA6 antikoerper, MDDGB6 antikoerper, BPFD36 antikoerper, Gyltl1a antikoerper, Mbp-1 antikoerper, Mbp1 antikoerper, enr antikoerper, fg antikoerper, froggy antikoerper, mKIAA0609 antikoerper, myd antikoerper, NV15834 antikoerper, DKFZp459G0120 antikoerper, LARGE xylosyl- and glucuronyltransferase 1 L homeolog antikoerper, LARGE xylosyl- and glucuronyltransferase 1 antikoerper, glycosyltransferase-like protein LARGE1 antikoerper, like-glycosyltransferase antikoerper, large1.L antikoerper, LARGE1 antikoerper, Large1 antikoerper, large1 antikoerper, LOC100118066 antikoerper, LARGE antikoerper, Large antikoerper

Hintergrund: This gene, which is one of the largest in the human genome, encodes a glycosyltransferase which participates in glycosylation of alpha-dystroglycan.

Molekulargewicht: 88 kDa (MW of target protein)