HS3ST3B1 Antikörper

Produktnummer ABIN635433

Produktdetails anti-HS3ST3B1 Antikörper

Target: HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HS3ST3B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: HS3 ST3 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HS3ST3B1 Blocking Peptide, catalog no. 33R-1387, is also available for use as a blocking control in assays to test for specificity of this HS3ST3B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HS3ST3B1

Target: HS3ST3B1 (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1))

Andere Bezeichnung: HS3ST3B1 (HS3ST3B1 Produkte)

Synonyme: 30ST3B1 antikoerper, 3OST3B1 antikoerper, 3-OST-3B antikoerper, 3Ost3b antikoerper, AU041882 antikoerper, AW536289 antikoerper, Hs3st3b antikoerper, m3-OST-3B antikoerper, zgc:152967 antikoerper, HS3ST3B1 antikoerper, heparan sulfate-glucosamine 3-sulfotransferase 3B1 antikoerper, heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1 antikoerper, heparan sulfate glucosamine 3-O-sulfotransferase 3B1 antikoerper, heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1b antikoerper, heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1a antikoerper, heparan sulfate glucosamine 3-O-sulfotransferase 3B1-like antikoerper, HS3ST3B1 antikoerper, Hs3st3b1 antikoerper, LOC489516 antikoerper, hs3st3b1b antikoerper, hs3st3b1a antikoerper, HS3ST3B1L antikoerper

Hintergrund: HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process