RER1 Antikörper

Produktnummer ABIN635434

Produktdetails anti-RER1 Antikörper

Target: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RER1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RER1 Blocking Peptide, catalog no. 33R-3349, is also available for use as a blocking control in assays to test for specificity of this RER1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RER1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RER1

Target: RER1 (RER1 Retention in Endoplasmic Reticulum 1 Homolog (RER1))

Andere Bezeichnung: RER1 (RER1 Produkte)

Synonyme: RER1 antikoerper, DKFZp459K116 antikoerper, rer1 antikoerper, zgc:65968 antikoerper, 1110060F11Rik antikoerper, 5830454N22Rik antikoerper, AU043380 antikoerper, RGD1306324 antikoerper, retention in endoplasmic reticulum sorting receptor 1 antikoerper, RER1 retention in endoplasmic reticulum 1 homolog (S. cerevisiae) antikoerper, retention in endoplasmic reticulum sorting receptor 1 L homeolog antikoerper, RER1 antikoerper, rer1 antikoerper, rer1.L antikoerper, Rer1 antikoerper

Hintergrund: RER1 is involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.

Molekulargewicht: 23 kDa (MW of target protein)