CHIC2 Antikörper (N-Term)

Produktnummer ABIN635436

Produktdetails anti-CHIC2 Antikörper

Target: CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHIC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: CHIC2 antibody was raised against the N terminal of CHIC2

Aufreinigung: Affinity purified

Immunogen: CHIC2 antibody was raised using the N terminal of CHIC2 corresponding to a region with amino acids EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHIC2 Blocking Peptide, catalog no. 33R-2382, is also available for use as a blocking control in assays to test for specificity of this CHIC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHIC2

Target: CHIC2 (Cysteine-Rich Hydrophobic Domain 2 (CHIC2))

Andere Bezeichnung: CHIC2 (CHIC2 Produkte)

Synonyme: zgc:55670 antikoerper, BTL antikoerper, 1700081B18Rik antikoerper, 4930502K01Rik antikoerper, cysteine rich hydrophobic domain 2 antikoerper, cysteine-rich hydrophobic domain 2 antikoerper, cysteine rich hydrophobic domain 2 S homeolog antikoerper, CHIC2 antikoerper, CpipJ_CPIJ013126 antikoerper, chic2 antikoerper, chic2.S antikoerper, Chic2 antikoerper

Hintergrund: CHIC2 is a member of the CHIC family of proteins. This protein contains a cysteine-rich hydrophobic (CHIC) motif, and is localized to vesicular structures and the plasma membrane. CHIC2 gene is associated with some cases of acute myeloid leukemia.

Molekulargewicht: 19 kDa (MW of target protein)